PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc003082.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 148aa    MW: 16469.1 Da    PI: 8.6794
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc003082.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR129.81.9e-0996135242
                     FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkre 42 
                              fY +YA+++GF+vr++++kk  r++eit++   Cs+ g+++
  Itr_sc003082.1_g00005.1  96 FYAAYATTTGFDVRRATEKKD-RQDEITWKYVLCSRAGSNS 135
                              9****************9998.5556************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.8E-696136IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MPYWAIQFGV HSGIALNVTH CRTEVHNAVM NRLRCAHMRL AVSESQFLLG VSDCADVTLV  60
LQRVHVGYTA CADVTLVLQR VHVGYTACAH LARVTFYAAY ATTTGFDVRR ATEKKDRQDE  120
ITWKYVLCSR AGSNSLLVKA TMLGCYLV